SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138098 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000138098
Domain Number - Region: 11-66
Classification Level Classification E-value
Superfamily Ras GEF 0.000889
Family Ras GEF 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138098   Gene: ENSMUSG00000024998   Transcript: ENSMUST00000182999
Sequence length 74
Comment pep:putative chromosome:GRCm38:19:38583368:38652007:1 gene:ENSMUSG00000024998 transcript:ENSMUST00000182999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKERQLGTSMANSNPVPSSSAGISKELIDLQPLIQFPEEVASILTEQEQNIYRRVLPMD
YLCFLTRDLSSPEC
Download sequence
Identical sequences S4R168
ENSMUSP00000138098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]