SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138330 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138330
Domain Number 1 Region: 1374-1543,1604-1677,1742-1841
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.79e-116
Family Mammalian PLC 0.00000492
Further Details:      
 
Domain Number 2 Region: 495-723,751-849
Classification Level Classification E-value
Superfamily Ras GEF 3.92e-39
Family Ras GEF 0.0052
Further Details:      
 
Domain Number 3 Region: 2127-2238
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.45e-36
Family Ras-binding domain, RBD 0.00000159
Further Details:      
 
Domain Number 4 Region: 2001-2107
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.03e-30
Family Ras-binding domain, RBD 0.00000386
Further Details:      
 
Domain Number 5 Region: 1867-1978
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-22
Family PLC-like (P variant) 0.0031
Further Details:      
 
Domain Number 6 Region: 1190-1221,1304-1362
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000599
Family EF-hand modules in multidomain proteins 0.032
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000138330
Domain Number - Region: 853-894,928-1005
Classification Level Classification E-value
Superfamily PH domain-like 0.00406
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138330   Gene: ENSMUSG00000024998   Transcript: ENSMUST00000182267
Sequence length 2296
Comment pep:novel chromosome:GRCm38:19:38524209:38782795:1 gene:ENSMUSG00000024998 transcript:ENSMUST00000182267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSEEMAASVLIPVTQRKVASAQSVAEERSVKVSDAGIPRARAGRQGALIPPTISQWNKH
KEESSRSDLSKVFSIARGELVCDENSNEEGWEENAPDSPENHAMNGNSLVQSHQHQFPRS
QLCEARDSVTEDPCLQPGIPSPLERKVLPGIQLEMEDSPMDVSPAGSQPRIMESSGPHSD
RNTAVFHFHYEADRTMSDAFHTLSENLILDDCANCVTLPGGQQNKNCMAYACKLVELTRT
CGSKNGQVQCEHCTSLRDEYLCFESSCSKADEVCSGGGFCEDGFAHGPAAKTFLNPLEDF
SDNCEDVDDFFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIMRTLPSGCIGPAAWNYV
DQKKAGLLWPCGNVMGTLSAMDIRQSGSQRLSEAQWCLIYSAVRRGEEIEDTVGSLLHCS
TQLPNSETAHGRIEDGPCLKQCVRDTECEFRATLQRTSIAQYITGSLLEATTSLGARSGL
LSSFGGSTGRIMLKERQLGTSMANSNPVPSSSAGISKELIDLQPLIQFPEEVASILTEQE
QNIYRRVLPMDYLCFLTRDLSSPECQRSLPRLKASISESILTSQSGEHNALEDLVMRFNE
VSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFM
DQSDIETMRSLKDAMAQHESSVEYKKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGL
LKLCPRYSSQEEALEFVADYSGQDNFLQRVGQNGLKNSEKELTVNSIFQVIRSCSRSLEM
EEEDSASEGSGSRKNSLKDKARWQFIIGDLLDSENDIFEKSKECDPHGSEESQKAFDHGT
ELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWMKPPTASPAG
ARPKLGVLSNMAEPGKFPSPGNAGVSGLAEGILDLFSVKAVYMGHPGIDIHTVCVQNKLS
SMLLSETGVTLLYGLQTTDNRLLHFVAPKHTAEMLFSGLLELTTAVRKIRRFPDQRQQWL
RKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGMSAKNAEKPNMQRNNTLGIST
TKKKKKMLMRGESGEVTDDEMATRKAKMYRECRSRSGSDPQDVNEQEESEANVITNPPNP
LHSRRAYSLTTAGSPNLATGMSSPISAWSSSSWHGRIRGGMQGFQSFMVSDSNMSFVEFV
ELFKSFSIRSRKDLKDIFDIYSVPCNRSASESAPLYTNLTIEENTSDLQPDLDLLTRNVS
DLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQLNDFLVNCQGE
HCTYDEILSIIQKFEPSVSMCHQGLLSFEGFARFLMDKDNFASKNDESRENKKELQLPLS
YYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSIELDCWDGDDGMPIIYHGHTLTTK
IPFKEVVEAIDRSAFITSDLPIIISIENHCSLPQQRKMAEIFKSVFGEKLVAKFLFETDF
SDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASMQAQAFTGGNANPPPASN
EEEEDEEDEYDYDYESLSDADVLTASPVPNSQEDNILEDRPENKSCADKLQFEYNEEVPK
RIKKADNSSGNKGKVYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNS
SGSSRGKERKSRKSIFGNNPGRMSPGETAPFNRTSGKGSCEGMRHTWEESSPLSPSTSLS
AIIRTPKCYHISSLNENAAKRLCRRGSQKLIQHTAYQLLRTYPAATRIDSSNPNPIMFWL
HGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKSCPMYQKFSPLERDLDNL
DPAIYSLTIISGQNVCPSNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLF
RVHFEDLVFLRFAVVENNSSAITAQRIIPLRALKRGYRHLQLRNLHNEILEISSLFINSR
RMEENPSGSSMPASLMFNTEERKCSQTHKVTVHGVPGPEPFAVFTINEGTKAKQLLQQVL
AVDQDTKCTATDYFLMEEKHFISKEKNECRKQPFQRAVGPEEDIVQILNSWFPEEGYVGR
IVLKPQQETLEEKSIVFDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQ
QTLCKAKYSYSILNNPNPCDYVLLEEVLKDAANKKSSTPKSSQRILLDQECVFQAQSKWK
GAGKFILKLKEQVQASREDKRRGISFASELKKLTKSTKQSRGLPSPPQLVASESVQSKEE
KPVGALSSSDTVGYQQ
Download sequence
Identical sequences S4R1Q8
ENSMUSP00000025962 ENSMUSP00000138330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]