SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138360 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138360
Domain Number 1 Region: 1374-1543,1590-1663,1728-1827
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.44e-116
Family Mammalian PLC 0.00000417
Further Details:      
 
Domain Number 2 Region: 495-723,751-849
Classification Level Classification E-value
Superfamily Ras GEF 3.79e-39
Family Ras GEF 0.0052
Further Details:      
 
Domain Number 3 Region: 2113-2224
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.45e-36
Family Ras-binding domain, RBD 0.00000159
Further Details:      
 
Domain Number 4 Region: 1987-2093
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.82e-30
Family Ras-binding domain, RBD 0.00000386
Further Details:      
 
Domain Number 5 Region: 1853-1964
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-22
Family PLC-like (P variant) 0.0031
Further Details:      
 
Domain Number 6 Region: 1190-1221,1304-1362
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000599
Family EF-hand modules in multidomain proteins 0.032
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000138360
Domain Number - Region: 853-894,928-1005
Classification Level Classification E-value
Superfamily PH domain-like 0.00406
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138360   Gene: ENSMUSG00000024998   Transcript: ENSMUST00000182481
Sequence length 2282
Comment pep:known chromosome:GRCm38:19:38481121:38783430:1 gene:ENSMUSG00000024998 transcript:ENSMUST00000182481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSEEMAASVLIPVTQRKVASAQSVAEERSVKVSDAGIPRARAGRQGALIPPTISQWNKH
KEESSRSDLSKVFSIARGELVCDENSNEEGWEENAPDSPENHAMNGNSLVQSHQHQFPRS
QLCEARDSVTEDPCLQPGIPSPLERKVLPGIQLEMEDSPMDVSPAGSQPRIMESSGPHSD
RNTAVFHFHYEADRTMSDAFHTLSENLILDDCANCVTLPGGQQNKNCMAYACKLVELTRT
CGSKNGQVQCEHCTSLRDEYLCFESSCSKADEVCSGGGFCEDGFAHGPAAKTFLNPLEDF
SDNCEDVDDFFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIMRTLPSGCIGPAAWNYV
DQKKAGLLWPCGNVMGTLSAMDIRQSGSQRLSEAQWCLIYSAVRRGEEIEDTVGSLLHCS
TQLPNSETAHGRIEDGPCLKQCVRDTECEFRATLQRTSIAQYITGSLLEATTSLGARSGL
LSSFGGSTGRIMLKERQLGTSMANSNPVPSSSAGISKELIDLQPLIQFPEEVASILTEQE
QNIYRRVLPMDYLCFLTRDLSSPECQRSLPRLKASISESILTSQSGEHNALEDLVMRFNE
VSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFM
DQSDIETMRSLKDAMAQHESSVEYKKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGL
LKLCPRYSSQEEALEFVADYSGQDNFLQRVGQNGLKNSEKELTVNSIFQVIRSCSRSLEM
EEEDSASEGSGSRKNSLKDKARWQFIIGDLLDSENDIFEKSKECDPHGSEESQKAFDHGT
ELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWMKPPTASPAG
ARPKLGVLSNMAEPGKFPSPGNAGVSGLAEGILDLFSVKAVYMGHPGIDIHTVCVQNKLS
SMLLSETGVTLLYGLQTTDNRLLHFVAPKHTAEMLFSGLLELTTAVRKIRRFPDQRQQWL
RKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGMSAKNAEKPNMQRNNTLGIST
TKKKKKMLMRGESGEVTDDEMATRKAKMYRECRSRSGSDPQDVNEQEESEANVITNPPNP
LHSRRAYSLTTAGSPNLATGMSSPISAWSSSSWHGRIRGGMQGFQSFMVSDSNMSFVEFV
ELFKSFSIRSRKDLKDIFDIYSVPCNRSASESAPLYTNLTIEENTSDLQPDLDLLTRNVS
DLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIFGVGILQLNDFLVNCQGE
HCTYDEILSIIQKFEPSVSMCHQGLLSFEGFARFLMDKDNFASKNDESRENKKELQLPLS
YYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSIELDCWDGDDGMPIIYHGHTLTTK
IPFKEVVEAIDRSAFITSDLPIIISIENHCSLPQQRKMAEIFKSVFGEKLVAKFLFETDF
SDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASMQAQAFTGGNANPPPASN
EEEEDEEDEYDYDYESLSDDNILEDRPENKSCADKLQFEYNEEVPKRIKKADNSSGNKGK
VYDMELGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNSSGSSRGKERKSRKS
IFGNNPGRMSPGETAPFNRTSGKGSCEGMRHTWEESSPLSPSTSLSAIIRTPKCYHISSL
NENAAKRLCRRGSQKLIQHTAYQLLRTYPAATRIDSSNPNPIMFWLHGIQLVALNYQTDD
LPLHLNAAMFEANGGCGYVLKPPVLWDKSCPMYQKFSPLERDLDNLDPAIYSLTIISGQN
VCPSNSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAV
VENNSSAITAQRIIPLRALKRGYRHLQLRNLHNEILEISSLFINSRRMEENPSGSSMPAS
LMFNTEERKCSQTHKVTVHGVPGPEPFAVFTINEGTKAKQLLQQVLAVDQDTKCTATDYF
LMEEKHFISKEKNECRKQPFQRAVGPEEDIVQILNSWFPEEGYVGRIVLKPQQETLEEKS
IVFDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILN
NPNPCDYVLLEEVLKDAANKKSSTPKSSQRILLDQECVFQAQSKWKGAGKFILKLKEQVQ
ASREDKRRGISFASELKKLTKSTKQSRGLPSPPQLVASESVQSKEEKPVGALSSSDTVGY
QQ
Download sequence
Identical sequences Q8K4S1
ENSMUSP00000130604 10090.ENSMUSP00000025962 NP_062534.2.92730 XP_011245682.1.92730 ENSMUSP00000130604 ENSMUSP00000138360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]