SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138555 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138555
Domain Number 1 Region: 135-187
Classification Level Classification E-value
Superfamily RING/U-box 1.54e-18
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138555   Gene: ENSMUSG00000029110   Transcript: ENSMUST00000182709
Sequence length 194
Comment pep:known chromosome:GRCm38:5:34336289:34353436:1 gene:ENSMUSG00000029110 transcript:ENSMUST00000182709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRNPQRKRRGGTVNSRQTQKRTRETTSTPEVSLETEPIELVETVGDEIVDLTCESLEP
VVVDLTHNDSVVIVEERRRPRRNGRRLRQDHADSCVVSSDDEELSRDKDVYVTTHTPRST
KDDGATGPRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTC
RKKINHKRYHPIYI
Download sequence
Identical sequences Q9QZS2
NP_001291198.1.92730 NP_001291199.1.92730 NP_035408.1.92730 ENSMUSP00000030992 ENSMUSP00000030992 ENSMUSP00000138411 ENSMUSP00000138555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]