SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138589 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138589
Domain Number 1 Region: 533-1007
Classification Level Classification E-value
Superfamily Ras GEF 6.93e-135
Family Ras GEF 0.000000000000303
Further Details:      
 
Domain Number 2 Region: 7-177
Classification Level Classification E-value
Superfamily Histone-fold 4.19e-51
Family TBP-associated factors, TAFs 0.000000245
Further Details:      
 
Domain Number 3 Region: 384-539
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-36
Family Pleckstrin-homology domain (PH domain) 0.00000193
Further Details:      
 
Domain Number 4 Region: 208-362
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.98e-27
Family DBL homology domain (DH-domain) 0.00000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138589   Gene: ENSMUSG00000034801   Transcript: ENSMUST00000182396
Sequence length 1300
Comment pep:novel chromosome:GRCm38:12:69585089:69681627:-1 gene:ENSMUSG00000034801 transcript:ENSMUST00000182396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQAPQPYEFFSEENSPKWRGLLVPALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
DIGLVSLCEDEPCSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLLDRKLFKPSE
IEKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQD
ILAPEFNDHFSKLMARPAVALHFQQLKACSEEQEDKECLNQAITALMNLQGSMDRIYKQH
SPRRRPGDPVCLFYNRQLRSKHLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIG
AKHERHIFLFDGLMISCKPNHGQTRLPGYSSAEYRLKEKFVMRKIQICDKEDACEYRHAF
ELVSKDENSVIFAAKSAEEKNNWMAALISLHYRSTLDRMLDSVLLKEENEQPLRLPSPDM
YRFVVTDSEENIVFEDNLQSRSGIPIIKGGTVVKLIERLTYHMYADPNFVRTFLTTYRSF
CKPQELLNLLIERFEIPEPEPTEADKLALEKGEQPISADLKRFRKEYVQPVQLRVLNVFR
HWVEHHYYDFERDLELLERLESFISSVRGKAMKKWVESIAKIIKRKKQAQANGISHNITF
ESSPPPVEWHISRTGQFETFDLMTLHPIEIARQLTLLESDLYRKVQPSELVGSVWTKEDK
EINSPNLLKMIRHTTNLTLWFEKCIVEAENFEERVAVLSRIVEILQVFQDLNNFNGVLEI
VSAVNSVSVYRLDHTFEALQERKRRILDDAVELSQDHFKKYLVKLKSINPPCVPFFGIYL
TNILKTEEGNSDFLKRKGKDLINFSKRRKVAEITGEIQQYQNQPYCLRTEPEMRRFFENL
NPMGILSEKEFTDYLFNKSLEIEPRNCKQPPRFPRKSTFSLKSPGIRPNAGRHGSTSGTL
RGHPTPLEREPYKISFSRIAETELESTVSAPTSPNTPSTPPVSASSDHSVFLDVDLNSSC
GSNTIFAPVLLPHSKTFFSSCGSLHKLSEEPLIPPPLPPRKKFDHDALNSKGAVKSDDDP
PAIPPRQPPPPKVKPRVPVLMGTFDGPVPSPPPPPPRDPLPDTPPPVPLRPPEHFINCPF
NLQPPPLGHPHRDPDWLRDVSTCPNSPSTPPTTPSPRIPRSCHLLSSSHSSLAHLPAPPV
PPRQNSSPLLPKLPPKTYKRELSHPPLYRLPLLENAETPQ
Download sequence
Identical sequences S4R2C4
ENSMUSP00000138589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]