SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138793 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138793
Domain Number 1 Region: 566-1040
Classification Level Classification E-value
Superfamily Ras GEF 7.32e-135
Family Ras GEF 0.000000000000303
Further Details:      
 
Domain Number 2 Region: 7-177
Classification Level Classification E-value
Superfamily Histone-fold 4.19e-51
Family TBP-associated factors, TAFs 0.000000245
Further Details:      
 
Domain Number 3 Region: 208-395
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-39
Family DBL homology domain (DH-domain) 0.000000205
Further Details:      
 
Domain Number 4 Region: 417-572
Classification Level Classification E-value
Superfamily PH domain-like 1.92e-36
Family Pleckstrin-homology domain (PH domain) 0.00000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138793   Gene: ENSMUSG00000034801   Transcript: ENSMUST00000183277
Sequence length 1333
Comment pep:known chromosome:GRCm38:12:69584853:69681841:-1 gene:ENSMUSG00000034801 transcript:ENSMUST00000183277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQAPQPYEFFSEENSPKWRGLLVPALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
DIGLVSLCEDEPCSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLLDRKLFKPSE
IEKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQD
ILAPEFNDHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLK
ACSEEQEDKECLNQAITALMNLQGSMDRIYKQHSPRRRPGDPVCLFYNRQLRSKHLAIKK
MNEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHGQTRLP
GYSSAEYRLKEKFVMRKIQICDKEDACEYRHAFELVSKDENSVIFAAKSAEEKNNWMAAL
ISLHYRSTLDRMLDSVLLKEENEQPLRLPSPDMYRFVVTDSEENIVFEDNLQSRSGIPII
KGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLNLLIERFEIPEPEPTEADKL
ALEKGEQPISADLKRFRKEYVQPVQLRVLNVFRHWVEHHYYDFERDLELLERLESFISSV
RGKAMKKWVESIAKIIKRKKQAQANGISHNITFESSPPPVEWHISRTGQFETFDLMTLHP
IEIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVE
AENFEERVAVLSRIVEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRIL
DDAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNSDFLKRKGKDLINFSKR
RKVAEITGEIQQYQNQPYCLRTEPEMRRFFENLNPMGILSEKEFTDYLFNKSLEIEPRNC
KQPPRFPRKSTFSLKSPGIRPNAGRHGSTSGTLRGHPTPLEREPYKISFSRIAETELEST
VSAPTSPNTPSTPPVSASSDHSVFLDVDLNSSCGSNTIFAPVLLPHSKTFFSSCGSLHKL
SEEPLIPPPLPPRKKFDHDALNSKGAVKSDDDPPAIPPRQPPPPKVKPRVPVLMGTFDGP
VPSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHPHRDPDWLRDVSTCPNSP
STPPTTPSPRIPRSCHLLSSSHSSLAHLPAPPVPPRQNSSPLLPKLPPKTYKRELSHPPL
YRLPLLENAETPQ
Download sequence
Identical sequences Q02384
ENSMUSP00000138793 ENSMUSP00000044866 XP_006515698.1.92730 ENSMUSP00000044866 10090.ENSMUSP00000044866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]