SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000139102 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000139102
Domain Number 1 Region: 119-294
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.56e-56
Family Matrix metalloproteases, catalytic domain 0.0000000563
Further Details:      
 
Domain Number 2 Region: 336-414
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.93e-23
Family Hemopexin-like domain 0.001
Further Details:      
 
Domain Number 3 Region: 29-106
Classification Level Classification E-value
Superfamily PGBD-like 3.3e-21
Family MMP N-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000139102   Gene: ENSMUSG00000028226   Transcript: ENSMUST00000183662
Sequence length 415
Comment pep:known chromosome:GRCm38:4:17852893:18117457:1 gene:ENSMUSG00000028226 transcript:ENSMUST00000183662 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MILLAFSSGRRLDFVHRSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRM
SVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNIRRKRY
ALTGQKWQHKHITYSIKNVTPKVGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKR
DVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDL
FLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKIPPPT
RPLPTVPPHRSVPPADPRRHDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVF
KDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKASWMTVFC
Download sequence
Identical sequences V9GXD8
ENSMUSP00000139102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]