SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000139343 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000139343
Domain Number 1 Region: 10-172
Classification Level Classification E-value
Superfamily RUN domain-like 4.71e-40
Family RUN domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000139343   Gene: ENSMUSG00000025241   Transcript: ENSMUST00000184082
Sequence length 366
Comment pep:known chromosome:GRCm38:9:123830013:123851881:-1 gene:ENSMUSG00000025241 transcript:ENSMUST00000184082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSTETQLQRIIRDLQDAATELSHEFKEGGEPITDDSTSLHKFSYKLEYLLQFDQKEK
ASLLGSKKDYWDYFCACLAKVKGANDGIRFVRSISELRTSLGKGRAFIRYSLVHQRLADT
LQQCFMNTKVTSDWYYARSPFLKPKLSSDIVGQLYELTEVQFDLAPRGYDLDAAWPTFAR
RTLATSTSAYMWKPPSRSSSMSSLVSNYLQTQEMASSLDLNCSLNNEALESFDEMRLELD
QLEVREKQLQERVQQLDRENQALRMLVSRQGGQLQVEKEMGYLAVEDSIGLVSLVAELQK
QGDVSQATVKKLQSCLQALELNVDKKEYSPSALQLENMAKELDTVRGSLGRENQLLASLS
ERLARA
Download sequence
Identical sequences ENSMUSP00000139343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]