SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000139822 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000139822
Domain Number 1 Region: 15-128
Classification Level Classification E-value
Superfamily Ras GEF 6.15e-27
Family Ras GEF 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000139822   Gene: ENSMUSG00000026594   Transcript: ENSMUST00000190762
Sequence length 128
Comment pep:known chromosome:GRCm38:1:156887093:156939134:-1 gene:ENSMUSG00000026594 transcript:ENSMUST00000190762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLMNGQASSVTIAATVSEKSSSSESLSEKGSELKKSFDAVVFDVLKVTPEEYAGQITLM
DVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEV
LSHYIKTA
Download sequence
Identical sequences A0A087WPL3
ENSMUSP00000139822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]