SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000139904 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000139904
Domain Number - Region: 27-62
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 0.000353
Family Myeloperoxidase-like 0.00031
Further Details:      
 
Domain Number - Region: 4-24
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00311
Family EGF-type module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000139904   Gene: ENSMUSG00000032487   Transcript: ENSMUST00000190784
Sequence length 62
Comment pep:putative chromosome:GRCm38:1:150100332:150101326:1 gene:ENSMUSG00000032487 transcript:ENSMUST00000190784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIP
FL
Download sequence
Identical sequences A0A087WPT2
ENSMUSP00000139904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]