SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140108 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000140108
Domain Number - Region: 14-66
Classification Level Classification E-value
Superfamily Ras GEF 0.00196
Family Ras GEF 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140108   Gene: ENSMUSG00000026594   Transcript: ENSMUST00000189648
Sequence length 67
Comment pep:known chromosome:GRCm38:1:156900598:156938781:-1 gene:ENSMUSG00000026594 transcript:ENSMUST00000189648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLMNGQASSVTIAATVSEKSSSSESLSEKGSELKKSFDAVVFDVLKVTPEEYAGQITLM
DVPVFKA
Download sequence
Identical sequences A0A087WQA4
ENSMUSP00000140108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]