SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140257 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000140257
Domain Number 1 Region: 5-37
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.0000683
Family D-ribulose-5-phosphate 3-epimerase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140257   Gene: ENSMUSG00000026005   Transcript: ENSMUST00000190404
Sequence length 50
Comment pep:known chromosome:GRCm38:1:66700907:66718019:1 gene:ENSMUSG00000026005 transcript:ENSMUST00000190404 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDAPCSSGRYAHDGV
Download sequence
Identical sequences A0A087WQM3
ENSMUSP00000140257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]