SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140291 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000140291
Domain Number - Region: 7-26
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000675
Family CCCH zinc finger 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140291   Gene: ENSMUSG00000056912   Transcript: ENSMUST00000186825
Sequence length 101
Comment pep:known chromosome:GRCm38:10:100592381:100618391:1 gene:ENSMUSG00000056912 transcript:ENSMUST00000186825 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAEVGNDCYFFVNSTCIKGSQCRFRHCEEALGSDTVCSLWRERKCLDPLCRFRHMEMQQN
CSISCFWETQPLGCVKISCIFYHSKPRNINGLFLPPSSRTK
Download sequence
Identical sequences A0A087WQP6
ENSMUSP00000140291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]