SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140342 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000140342
Domain Number 1 Region: 15-290
Classification Level Classification E-value
Superfamily Ras GEF 3.14e-81
Family Ras GEF 0.0000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140342   Gene: ENSMUSG00000026594   Transcript: ENSMUST00000188656
Sequence length 489
Comment pep:putative chromosome:GRCm38:1:156818896:156938818:-1 gene:ENSMUSG00000026594 transcript:ENSMUST00000188656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLMNGQASSVTIAATVSEKSSSSESLSEKGSELKKSFDAVVFDVLKVTPEEYAGQITLM
DVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEV
LSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKE
DNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIIS
DLQQSCEYDIPILPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGASTPRSAASREDL
AGPDIGASPQGGRKSSAAAAAAAAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMN
TAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWPA
FERNRLYHSLGPVTRVPRNGYRSHTKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKEG
KKPTVRLTS
Download sequence
Identical sequences A0A087WQU0
ENSMUSP00000140342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]