SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000141005 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000141005
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.46e-38
Family Galectin (animal S-lectin) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000141005   Gene: ENSMUSG00000053964   Transcript: ENSMUST00000151547
Sequence length 160
Comment pep:known chromosome:GRCm38:7:28834523:28841214:1 gene:ENSMUSG00000053964 transcript:ENSMUST00000151547 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
ENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKH
FELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYP
GAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPVWCPRG
Download sequence
Identical sequences A0A087WSD9
ENSMUSP00000141005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]