SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000000430 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000000430
Domain Number 1 Region: 95-421
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 7.22e-70
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000000000545
Further Details:      
 
Domain Number 2 Region: 425-553
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.37e-40
Family Ricin B-like 0.000000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000000430   Gene: ENSMUSG00000000420   Transcript: ENSMUST00000000430
Sequence length 559
Comment pep:known chromosome:GRCm38:18:24205344:24286818:1 gene:ENSMUSG00000000420 transcript:ENSMUST00000000430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKFAYCKVVLATSLVWVLLDMFLLLYFSECNKCEEKQERGLPAGDVLELVQKPHEGPGE
MGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSV
VIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHV
IRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDV
ISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDR
DYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQ
IINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYP
DSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDD
LCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDC
TGSRSQQWLLRNVTLPEIF
Download sequence
Identical sequences O08912
ENSMUSP00000000430 ENSMUSP00000000430 ENSMUSP00000132142 ENSMUSP00000137427 NP_001153876.1.92730 NP_038842.3.92730 XP_006525713.1.92730 10090.ENSMUSP00000000430 ENSMUSP00000000430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]