SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000000646 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000000646
Domain Number 1 Region: 413-524
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-22
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 590-700
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-20
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 707-772
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000058
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 766-828
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000839
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 5 Region: 353-418
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000431
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 833-894
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000139
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 7 Region: 236-354
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000106
Family Spermadhesin, CUB domain 0.0089
Further Details:      
 
Domain Number 8 Region: 529-593
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000195
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000000646   Gene: ENSMUSG00000000632   Transcript: ENSMUST00000000646
Sequence length 977
Comment pep:known chromosome:GRCm38:11:77931012:77979040:1 gene:ENSMUSG00000000632 transcript:ENSMUST00000000646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAALLLLPSLLALLAHGLSSEAPITGEGHATGIRETDGELTAAPTPEQSDRGVHFVTT
APTLKLLNHHPLLEEFLQEGLEREEAPQPALPFQPDSPTHFTPSPLPRLTNQDNRPVFTS
PTPAVAAAPTQPHSREKPWNLESKPPELSITSSLPPGPSMAVPTLLPEDRPSTTPPSQAW
TPTQEGPGDMDRPWVPEVMSKTTGLGVEGTIATSTASGDDEETTTTIITTTVTTVQPPGP
CSWNFSGPEGSLDSPTAPSSPSDVGLDCFYYISVYPGYGVEIKVENISLQEGETITVEGL
GGPDPLPLANQSFLLRGQVIRSPTHQAALRFQSLPLPAGPGTFHFRYQAYLLSCHFPRRP
AYGDVTVTSLHPGGSAHFHCATGYQLKGARFLTCLNATQPFWDSQEPVCIAACGGVIRNA
TTGRIVSPGFPGNYSNNLTCHWLLEAPESQRLHLHFEKVSLAEDDDRLIIRNGNNVEAPP
VYDSYEVEYLPIEGLLSSGRHFFVEFSTDSSGAAAGMALRYEAFQQGHCYEPFVKYGNFS
SSAPSYPVGTTVEFSCDPGYTLEQGSIIIECVDLHDPQWNETEPACRAVCSGEITDSAGV
VLSPNWPEPYGRGQDCIWGVHVEEDKRIMLDIRVLRIGSGDVLTFYDGDDLTARVLGQYS
GPRGHFKLFTSMADVTIQFQSDPGTSALGYQQGFVIHFFEVPRNDTCPELPEIPNGWKNP
SQPELVHGTVVTYQCYPGYQVVGSSILMCQWDLSWSEDLPSCQRVTSCHDPGDVEHSRRL
ISSPKFPVGATVQYVCDQGFVLTGSAILTCHDRQAGSPKWSDRAPKCLLEQFKPCHGLSA
PENGARSPEKRLHPAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAVAKAPA
ASSALDAAHLAAAIFLPLVAMVLLVGGVYLYFSRFQGKSPLQLPRTHPRPYNRITVESAF
DNPTYETGETREYEVSI
Download sequence
Identical sequences ENSMUSP00000000646 NP_001278154.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]