SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000002320 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000002320
Domain Number 1 Region: 175-439
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.37e-87
Family Nuclear receptor ligand-binding domain 0.000000000244
Further Details:      
 
Domain Number 2 Region: 70-153
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-26
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000002320   Gene: ENSMUSG00000002250   Transcript: ENSMUST00000002320
Sequence length 440
Comment pep:known chromosome:GRCm38:17:28232754:28301469:1 gene:ENSMUSG00000002250 transcript:ENSMUST00000002320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMG
CDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRICKIQKKN
RNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKH
IYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAEKGLVWKQLVNGLPPYNEI
SVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKD
GLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDR
PGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLK
KTESETLLHPLLQEIYKDMY
Download sequence
Identical sequences P35396 Q546I3
10090.ENSMUSP00000002320 ENSMUSP00000002320 NP_035275.1.92730 ENSMUSP00000002320 ENSMUSP00000002320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]