SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000002336 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000002336
Domain Number 1 Region: 44-105
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 361-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 305-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 403-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 268-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-16
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 6 Region: 473-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000182
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 515-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000439
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000002336   Gene: ENSMUSG00000002266   Transcript: ENSMUST00000002336
Sequence length 579
Comment pep:known chromosome:GRCm38:7:6675443:6696450:-1 gene:ENSMUSG00000002266 transcript:ENSMUST00000002336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRSVSEVKTKAPVNEASPSPSPDQTANQLSEKKRRIPITSLPTWYKEPVIFKDVAVYFS
QKEWQLLEPAQKDLYKDVMLENYENLISVEYYIFKPKLITRLEQGVDLFAKENDVPGDPQ
QGEAGVSRSDTSAGKKTGDNSTKAEIRKPDNSKTTSLEKQKAADQGRGSQSLRAEKTSKS
DDRPSQNKEKCASTSTTEASKTSIPGNKENESAIPGTSSGQTSAATTTPQSAPSEKPTSG
KDVEGKPQTMRSSSTNPKRKPARQGKNHFKCKECGKTFNQTLHLVEHERIHTGEKPHKCD
TCGKSFRHLSYFLTHYRIHTGVRPYKCKECGKAFNSSSTLNNHCRIHSGEKPFKCDECGK
TFKQSTKLTRHQRIHTGEKPYKCGECNKCFGRSSSLREHKRIHTGEKPYCCQVCGKTFRV
NSHLSEHQRLHLKVKPYKCDKCGKHFRNSSYLTEHKQIHVPGARVDCPECGKVFACKVAL
LKHQKRHEANSRYRCKGCGKTFRCKSSIQRHERLHAGEKPFVCHKCDKGFTDKTTLNNHL
KIHSGDRPDPCAQCGRTFKKLATLLIHQKKHIKKKPTDV
Download sequence
Identical sequences Q8C393
ENSMUSP00000002336 NP_035899.4.92730 XP_011248797.1.92730 XP_011248799.1.92730 XP_011248801.1.92730 ENSMUSP00000002336 ENSMUSP00000113585 10090.ENSMUSP00000113585 ENSMUSP00000002336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]