SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000006112 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000006112
Domain Number 1 Region: 621-922
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.02e-81
Family Protein kinases, catalytic subunit 0.000000000335
Further Details:      
 
Domain Number 2 Region: 31-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.42e-72
Family Ephrin receptor ligand binding domain 0.000000264
Further Details:      
 
Domain Number 3 Region: 330-538
Classification Level Classification E-value
Superfamily Fibronectin type III 4.41e-40
Family Fibronectin type III 0.0000947
Further Details:      
 
Domain Number 4 Region: 917-990
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.75e-21
Family SAM (sterile alpha motif) domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000006112
Domain Number - Region: 258-328,384-389
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000141
Family Growth factor receptor domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000006112   Gene: ENSMUSG00000005958   Transcript: ENSMUST00000006112
Sequence length 993
Comment pep:known chromosome:GRCm38:16:21204755:21223304:1 gene:ENSMUSG00000005958 transcript:ENSMUST00000006112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGARPPPGLLPLLAPLLLPLLLPAGCWALEETLMDTKWVTSELAWTSHPESGWEEVSGY
DEAMNPIRTYQVCNVRESSQNNWLRTGFIWRREVQRVYVELKFTVRDCNSIPNIPGSCKE
TFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRSFGPLSKAG
FYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGTCIANAVEV
SVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRACPPGSYKAKQGEGPCLPCPPNS
RTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWSEPRDLGGR
DDLLYNVICKKCRGSSGAGGPATCSRCDDNVEFVPRQLGLTERRVHISHLLAHTRYTFEV
QAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLHLHSSSGSSLTLSWAPPERPNGVILD
YEMKYFEKSKGIASTVTSQKNSVQLDGLQPDARYVVQVRARTVAGYGQYSHPAEFETTSE
RGSGAQQLQEQLPLIVGSTVAGFVFMVVVVVIALVCLRKQRHGPDAEYTEKLQQYIAPGM
KVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKLPGRREVFVAIK
TLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDSFLRL
NDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLED
DPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQ
DVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAASLKVT
ASAPSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVGAGFASFDLVAQMTAEDL
LRIGVTLAGHQKKILCSIQDMRLQMNQTLPVQV
Download sequence
Identical sequences P54754
ENSMUSP00000006112 10090.ENSMUSP00000006112 ENSMUSP00000006112 ENSMUSP00000006112 NP_034273.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]