SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000011733 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000011733
Domain Number 1 Region: 335-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-30
Family SPRY domain 0.0024
Further Details:      
 
Domain Number 2 Region: 157-267
Classification Level Classification E-value
Superfamily Fibronectin type III 4.33e-17
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000011733   Gene: ENSMUSG00000011589   Transcript: ENSMUST00000011733
Sequence length 496
Comment pep:known chromosome:GRCm38:17:55986511:55996881:1 gene:ENSMUSG00000011589 transcript:ENSMUST00000011733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDQREALRKIITTLAMKNEETQTFIYSLKQMLLNVEANSAKVQEDLEAEFQSLTSVLEE
LKESMLMKIKQDRASRTYELQNQLAACTRALESSEELLETANQTLQASDSEDFSQAAKEI
KDGITMAPAFRLSLKAKVSDNMSHLMVDFAQERQMLQALKFLPVPSAPTIDLAESLVSDN
CVTLVWHMPDEDSKIDHYVLEYRKTNFEGPPRLKEDHPWMVVEGIRQTEHTLTGLKFDMK
YMNIRVKACNKAVAGEFSEPVTLETPAFMFRLDGSTSHQNLRVEDLSAEWDAMGGKVQDI
KAREKEGKGRTASPVNSPARGTPSPKRMSSGRGGRDRFTAESYTVLGDTLIDGGEHYWEV
RFEPDSKAFGLGVAYRSLGRFEQLGKTAASWCLHANNWLQASFTAKHANKVKVLDSPVPD
CLGVHCDFHQGLLSFYNARTKQLLHTFKAKFTQPLLPAFTVWCGSFQVTTGLQVPSAVRC
LQKRGSATSSSNTSLT
Download sequence
Identical sequences Q7TPM6
ENSMUSP00000011733 NP_899001.1.92730 ENSMUSP00000011733 ENSMUSP00000011733 10090.ENSMUSP00000011733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]