SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000015987 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000015987
Domain Number 1 Region: 189-457
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.33e-84
Family Nuclear receptor ligand-binding domain 0.00000000356
Further Details:      
 
Domain Number 2 Region: 136-218
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.5e-31
Family Nuclear receptor 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000015987   Gene: ENSMUSG00000015843   Transcript: ENSMUST00000015987
Sequence length 463
Comment pep:known chromosome:GRCm38:1:167598384:167639623:1 gene:ENSMUSG00000015843 transcript:ENSMUST00000015987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGNYSHFMKFPTGFGGSPGHTGSTSMSPSVALPTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSSHEDMPVERIL
EAELAVEPKTESYGDMNVENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDSFLMEMLETPLQIT
Download sequence
Identical sequences P28705
ENSMUSP00000015987 ENSMUSP00000015987 ENSMUSP00000107015 ENSMUSP00000107017 NP_033133.1.92730 10090.ENSMUSP00000107017 ENSMUSP00000015987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]