SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021120 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021120
Domain Number 1 Region: 424-576
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-25
Family SPRY domain 0.011
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 8.95e-17
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 174-236
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000275
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021120   Gene: ENSMUSG00000020773   Transcript: ENSMUST00000021120
Sequence length 642
Comment pep:known chromosome:GRCm38:11:116105752:116110246:-1 gene:ENSMUSG00000020773 transcript:ENSMUST00000021120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGSGPFSCPICLEPLREPVTLPCGHNFCLACLGALWPHRSAGGTGGSGGPARCPLCQEP
FPDGLQLRKNHTLSELLQLRQGSVPGPMSAPASGSTRGATPEPSAPSAPPPAPEPSAPCA
PEQWPAGEEPVRCDACPEGAALPAALSCLSCLASFCSAHLAPHERSPALRGHRLVPPLRR
LEESLCPRHLRPLERYCRVERVCLCEACATQDHRGHELVPLEQERALQEVEQSKVLSAAE
DRMDELGAGIAQSRRTVALIKSAAVAERERVSQMFAEATATLQSFQNEVMGFIEEGEATM
LGRSQGDLRRQEEQRSRLSKARHNLGQVPEADSVSFLQELLALRLALEEGCGPGPGPPRE
LSFTKSSQVVKAVRDTLISACASQWEQLRGLGSNEDGLQKLGSEADVESQDPDSTSLLES
EAPRDYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPESPTRFTHCEQVLGEGA
LDRGTYYWEVEIIEGWVSVGVMAEGFSPQEPYDRGRLGRNAHSCCLQWNGRGFSVWFCGL
EAPLPHAFSPTVGVCLEYADHALAFYAVRDGKLSLLRRLKASRPRRSGALASPTDPFQSR
LDSHFSGLFNHRLKPAFFLESVDAHLQIGPLKKSCITVLKRR
Download sequence
Identical sequences ENSMUSP00000021120 ENSMUSP00000021120 ENSMUSP00000102049 NP_001192010.1.92730 10090.ENSMUSP00000021120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]