SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021558 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021558
Domain Number 1 Region: 102-422
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.38e-60
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000449
Further Details:      
 
Domain Number 2 Region: 417-554
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.98e-25
Family Ricin B-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021558   Gene: ENSMUSG00000021130   Transcript: ENSMUST00000021558
Sequence length 558
Comment pep:known chromosome:GRCm38:12:80518990:80603896:1 gene:ENSMUSG00000021130 transcript:ENSMUST00000021558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKIRANAIAILTVAWILGTFYYLWQDNRAHAASSSGRGAQRAGGRPEQLREDRTIPLIV
TGTPSKGFDEKAYLSAKQLKPGEDPYRQHAFNQLESDKLSSDRPIRDTRHYSCPSLSYSS
DLPATSVIITFHNEARSTLLRTVKSVLNRTPASLIQEIILVDDFSSDPEDCLLLTRIPKV
KCLRNDKREGLIRSRVRGADVAGATVLTFLDSHCEVNVEWLQPMLQRVMEDHTRVVSPII
DVISLDNFAYLAASADLRGGFDWSLHFKWEQIPLEQKMTRTDPTKPIRTPVIAGGIFVID
KSWFNHLGKYDAQMDIWGGENFELSFRVWMCGGSLEIVPCSRVGHVFRKRHPYNFPEGNA
LTYIRNTKRTAEVWMDEYKQYYYEARPSAIGKAFGSVATRIEQRKKMDCKSFRWYLENVY
PELTVPVKEVLPGVIKQGVNCLESQGQNTAGDLLLGMGICRGSAKSPPPAQAWLFSDHLI
QQQGKCLAATSTLMSSPGSPVILQTCNPKEGKQKWRRKGSFIQHSVSGLCLETKPAQLVT
SKCQTDAQAQQWQLLPHT
Download sequence
Identical sequences Q9JJ61
ENSMUSP00000021558 NP_001074890.1.92730 ENSMUSP00000021558 10090.ENSMUSP00000021558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]