SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022304 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022304
Domain Number 1 Region: 229-473
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.39e-72
Family Nuclear receptor ligand-binding domain 0.000000000284
Further Details:      
 
Domain Number 2 Region: 119-208
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.75e-28
Family Nuclear receptor 0.00000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022304   Gene: ENSMUSG00000021779   Transcript: ENSMUST00000022304
Sequence length 475
Comment pep:known chromosome:GRCm38:14:17981644:18038086:1 gene:ENSMUSG00000021779 transcript:ENSMUST00000022304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIYMEQAWAVNQP
YTCSYPGNLFKSKDSDLDMALSQSSQPAHLPEEKPFPQVQSPPHSQKKGYIPSYLDKDEL
CVVCGDKATGYHYRCITCEGCKGFFRRTIQKSLHPSYSCKYEGKCIIDKVTRNQCQECRF
KKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVT
EAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDF
AKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPDSETLTLNGEMAVTRGQLKNGGL
GVVSDAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHY
INYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences 10090.ENSMUSP00000022304 NP_033406.1.92730 ENSMUSP00000022304 ENSMUSP00000022304 ENSMUSP00000022304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]