SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022460 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022460
Domain Number 1 Region: 171-494
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.25e-51
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000189
Further Details:      
 
Domain Number 2 Region: 490-629
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.6e-28
Family Ricin B-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022460   Gene: ENSMUSG00000021903   Transcript: ENSMUST00000022460
Sequence length 638
Comment pep:known chromosome:GRCm38:14:32028989:32062197:1 gene:ENSMUSG00000021903 transcript:ENSMUST00000022460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRKRPRSGRSRLQFLLLFLTLGCVLMMVILLHPPPPTLHQAVTAQASKHSPDTGYRLD
FGDSQEWVLEAETEGDEYSLLDGLPSFISLQEDQLLVAVASPRARRSQSQGRRQGSYQFI
KHRSRRWDEEALEKDWRTEEDGEESEEVLTPLGPDSDGLNKPLSARLPLRRVLPEVRHPL
CLQQHPTSGLPTASVILCFHDEAWPTLLRTVHSILDTAPRALLQEIILVDDLSQQELLKS
ALSEYVARLEAVKLLRSNRRLGTIGARMLGATRATGDVLVFMDAHCECHPGWLEPLLSRI
ADDRSRVVSPVIDVIDWKTLQYSASKLHRGTLDWKLDFRWKPLGEQEQKALPSPISPVRS
PVVPREVVAVDRHYFQNTGAYDPLLSLGDSENLEMSFKAWLCGGSVEILPCSRVGHIYRS
QDASSRPDPEVALKNKIIIAETWLSSFKETFYRHIPEAFTLSKVAKPDCTERLKLQRRLG
CRTFHWFLANVYPELYPSDHRPRFSGKLHNTGFGLCADCQADGDILGCPMTLAPCSNNRQ
QQNLEHTGRKEILFGGPQRLCFDVRGGRVILQNCTEEGPAIHQQHWDFQEDGMIIHVLSG
KCMEAGVQPSNKDLYLRQCDGKTSQLWRFDQIHPVDER
Download sequence
Identical sequences Q9D2N8
NP_084442.1.92730 ENSMUSP00000022460 ENSMUSP00000022460 ENSMUSP00000022460 10090.ENSMUSP00000022460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]