SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022788 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022788
Domain Number 1 Region: 644-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000297
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 2 Region: 141-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000536
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 4 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000706
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 5 Region: 699-754
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000202
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number 6 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000732
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000022788
Domain Number - Region: 516-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0921
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022788   Gene: ENSMUSG00000022181   Transcript: ENSMUST00000022788
Sequence length 769
Comment pep:known chromosome:GRCm38:15:4727216:4803642:1 gene:ENSMUSG00000022181 transcript:ENSMUST00000022788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRHLTLCFILLVMLIDKSEACFCDHYPWTHWSSCSKSCNSGTQSRQRQVVVNDYYWKNL
CDKLCIKQETRECNLQTCPINCVLGDYGTWSDCDPCTEKQVKVKSVLRPSQFGGQPCTEP
LVTFQPCVPSKLCKIEETNCKNKFLCDSGRCIPSKLECNGENDCGDNSDERNCGRTKPVC
TRIYTPIPSVQLMGTGFHFLAGEPRGEVLDNSFTGGICKLVKTSRASNPYRVSANLENVN
FEVQTIEDDLKTEFYKNLISFEKNKNEDSLSVDERTKFFPIPIFHFSEKNEHSHYSSAFN
KVIKASHKKDSSFIRIHKLIKVLNFTMKATDLQLSDVFLKALVHLPLEYNSAVYSRIFDD
FGTHYFTSGSLGGKYDLIYQFSRQELQNSGLTEEEAQNCVQYETKKLKFLYMEIHKEDTC
TKNKLSEKYGGSFLQGSEKSISLVQGGRSQQAAALAWEKGTSGPEENVYSEWLESVKENP
AVVDYKLAPITDLVRNIPCAVTKRNNLRRALQEYAAKFDPCQCAPCPNNGRPRLSGTECL
CVCQSGTYGENCERRSPGYKSDAVDGNWGCWSSWSACNAAYRRSRTRECNNPAPQRGGQS
CGGKDQQEEDCTVSIMENVGQPCINDDEEMKEVDLAEPEAESGCSQPPLPENAFTWNEKK
LYSVGEEVEISCLTGFTAVGFQYLRCLPDRTWSQGDVECQRTSCLKPVVQDVLTISPFQR
VYQIGESIELTCPRGFVVAGPSRYTCKEDSWTPPISNSLTCEQGVRDHP
Download sequence
Identical sequences Q91X70
ENSMUSP00000022788 ENSMUSP00000124417 10090.ENSMUSP00000022788 NP_057913.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]