SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000023448 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000023448
Domain Number 1 Region: 187-502
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.71e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0074
Further Details:      
 
Domain Number 2 Region: 71-168
Classification Level Classification E-value
Superfamily ISP domain 9.3e-26
Family Rieske iron-sulfur protein (ISP) 0.029
Further Details:      
 
Domain Number 3 Region: 506-591
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.85e-21
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000023448   Gene: ENSMUSG00000022763   Transcript: ENSMUST00000023448
Sequence length 598
Comment pep:known chromosome:GRCm38:16:17489663:17507485:1 gene:ENSMUSG00000022763 transcript:ENSMUST00000023448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRGYQGNGTARHFHAEERLPTPQP
YPSPQDCVEATVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGV
LSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVTIRASKQALQLQRRTKV
MAKCISPSAGHSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRAKLSK
SLDAQPEQLALRPKEFFRAYGIEMLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSS
PKTLTCKGKDVENVFTIRTPEDANRVLRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSV
VELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRAQEGKLQEVVLKSSKVLRA
DVCVLGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRK
VNIPHWQMAHAQGRVAAQNMLAQEAEINTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDL
EELKFVAFYTKSDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS
Download sequence
Identical sequences ENSMUSP00000023448 NP_780387.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]