SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000024858 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000024858
Domain Number 1 Region: 90-410
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.53e-65
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000277
Further Details:      
 
Domain Number 2 Region: 402-547
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.31e-24
Family Ricin B-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000024858   Gene: ENSMUSG00000024064   Transcript: ENSMUST00000024858
Sequence length 550
Comment pep:known chromosome:GRCm38:17:73493228:73710451:-1 gene:ENSMUSG00000024064 transcript:ENSMUST00000024858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLTRRLALPIFGVLWITVLLFFWVTKRKLEVPLGPEVQTPKPSDADWDDLWEQFDERR
YLNAKKWRVGDDPYKLYAFNQRESERISSNRAVPDTRHKRCSLLVYCTDLPPTSIIITFH
NEARSTLLRTIRSVLNRTPMHLIQEIILVDDFSNDPEDCKQLIKLPKVKCLRNNERQGLV
RSRMRGADIAQGTTLTFLDSHCEVNRDWLQPLLHRVKEDYTRVVCPVIDIINLDTFNYIE
SASELRGGFDWSLHFQWEQLSLEQKALRLDPTEPIRTPIIAGGLFVIDKAWFDYLGKYDV
DMDIWGGENFEISFRVWMCGGGLEIIPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAE
VWMDEYKQYYYAARPFALERPFGNIENRLNLRKNLHCQTFKWYLENVYPELRVPPDSSIQ
KGNIRQRQKCLESQKQKKQEILRLSPCAKVKGDGAKSQVWAFTYTQQIIQEELCLSVVTL
FPGAPVVLALCKNGDERQLWTKTGARIEHIASHLCLDTDMFGDSTEDGKEVVVNPCESSL
MSQHWDIVSS
Download sequence
Identical sequences Q08EC9
NP_082140.2.92730 ENSMUSP00000024858 ENSMUSP00000024858 10090.ENSMUSP00000024858 ENSMUSP00000024858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]