SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025127 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025127
Domain Number 1 Region: 43-172
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-49
Family Calponin-homology domain, CH-domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 242-302
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 9.15e-19
Family EB1 dimerisation domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025127   Gene: ENSMUSG00000024277   Transcript: ENSMUST00000025127
Sequence length 326
Comment pep:known chromosome:GRCm38:18:23803984:23893857:1 gene:ENSMUSG00000024277 transcript:ENSMUST00000025127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPTQTLSPNGENNNDIIQDNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRH
DIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLL
QASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPP
PDPGEQIFNLPKKSHHANSPTAGAAKSSPASKPGSTPSRPSSAKRASSSGSASRSDKDLE
TQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMEVLYASD
EQEGQTEEPEAEEQAHDQQPQQQEEY
Download sequence
Identical sequences Q8R001
10090.ENSMUSP00000025127 ENSMUSP00000025127 ENSMUSP00000025127 NP_694698.3.92730 ENSMUSP00000114113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]