SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025503 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025503
Domain Number 1 Region: 106-290
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 9.55e-51
Family Isochorismatase-like hydrolases 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025503   Gene: ENSMUSG00000024601   Transcript: ENSMUST00000025503
Sequence length 297
Comment pep:known chromosome:GRCm38:18:58659482:58679570:1 gene:ENSMUSG00000024601 transcript:ENSMUST00000025503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAEPSVAALAGGGVGAGAPSGGVPVLFCFSVFARPASVPHGAGYDVLIQKFLSLYGDQ
LDMHRKFVVQLFAEEWGQYVDLPKGFAVSERCKLRLVPLQIQLTTLGNLTPPSTVFFCCD
MQERFRPAIKYFGDIISVGQRLLQGARILGIPVIITEQYPKGLGSTVQEIDLTGVKLVLP
KTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGIEVHIVADATSSRS
MMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Download sequence
Identical sequences F2Z3T7 Q91V64
ENSRNOP00000026706 NP_079754.2.92730 XP_008772040.1.100692 ENSMUSP00000025503 ENSMUSP00000025503 10090.ENSMUSP00000025503 10116.ENSRNOP00000026706 ENSMUSP00000025503 ENSRNOP00000026706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]