SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025866 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025866
Domain Number 1 Region: 234-273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000144
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 2 Region: 31-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000301
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 3 Region: 272-312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 4 Region: 149-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000011
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 5 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 6 Region: 187-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 7 Region: 107-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.00018
Further Details:      
 
Domain Number 8 Region: 396-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000364
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 9 Region: 360-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 10 Region: 318-355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000109
Family LDL receptor-like module 0.0004
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000025866
Domain Number - Region: 443-494
Classification Level Classification E-value
Superfamily YWTD domain 0.0602
Family YWTD domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025866   Gene: ENSMUSG00000024924   Transcript: ENSMUST00000025866
Sequence length 498
Comment pep:known chromosome:GRCm38:19:27217458:27249763:1 gene:ENSMUSG00000024924 transcript:ENSMUST00000025866 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGTSARWALWLLLALCWAPRDSGATASGKKAKCDSSQFQCTNGRCITLLWKCDGDEDCAD
GSDEKNCVKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCHMRTCRINEISC
GARSTQCIPVSWRCDGENDCDNGEDEENCGNITCSADEFTCSSGRCVSRNFVCNGQDDCD
DGSDELDCAPPTCGAHEFQCSTSSCIPLSWVCDDDADCSDQSDESLEQCGRQPVIHTKCP
TSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGI
RDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDMSKVCDQEQDCRDWSDEPLKECHINEC
LVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCE
CSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAA
QKLFWADLSQKAIFSHCC
Download sequence
Identical sequences F8WIN7
ENSMUSP00000025866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]