SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025906 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025906
Domain Number 1 Region: 129-155,183-420
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.44e-69
Family Nuclear receptor ligand-binding domain 0.00000000199
Further Details:      
 
Domain Number 2 Region: 76-161
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-30
Family Nuclear receptor 0.00000936
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025906   Gene: ENSMUSG00000024955   Transcript: ENSMUST00000025906
Sequence length 422
Comment pep:known chromosome:GRCm38:19:6910977:6921808:-1 gene:ENSMUSG00000024955 transcript:ENSMUST00000025906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVTLASGPAPARCLPGHKEEEDGEGAG
SGEQGSGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGP
LAVAGGPRKTAPVNALVSHLLVVEPEKLYAMPDPASPDGHLPAVATLCDLFDREIVVTIS
WAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAG
LGDLGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALLE
YEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEAM
MD
Download sequence
Identical sequences O08580 Q5QJV7
NP_001008511.2.100692 NP_001008511.2.4139 NP_031979.2.92730 ENSRNOP00000028697 ENSRNOP00000028697 ENSMUSP00000025906 10116.ENSRNOP00000028697 ENSMUSP00000025906 ENSMUSP00000025906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]