SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000026693 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000026693
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.41e-39
Family SCAN domain 0.0000496
Further Details:      
 
Domain Number 2 Region: 482-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 3 Region: 584-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.59e-18
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 399-441,468-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.64e-17
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 231-290
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000222
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 
Domain Number 6 Region: 538-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000157
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000026693   Gene: ENSMUSG00000025602   Transcript: ENSMUST00000026693
Sequence length 641
Comment pep:known chromosome:GRCm38:9:40192317:40213189:1 gene:ENSMUSG00000025602 transcript:ENSMUST00000026693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATALEPEDQDLWEEEGVLMVKLEDDFTCGPESALEGDDPVLETSHQNFRRFRYQEASSP
REALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTVHVQGQEVLSEETLHLGLEPESSSEQQDPTQTLTTEQPHEEALR
SPDLGTQEQETLQHDEEHLPLPECEVPVSQDVDLPTEQGSGHPEMVALLTALSQGLVTFK
DVALCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFPIPRLDDTSQIREEEPQVPGV
HESQEPAEPEILSFTYTGDMSEAEEESVEQQDTHKSTLANTEVHQSPDWEIVIEDNTSRL
NERFGTNVSKVNSFTNIRETMPVHSQSGRQHHCPLCAKSFTCNSHLIRHLRTHTGEKPYK
CMECGKSYTRSSHLARHQKVHKMNTPHKHPPNRKTVDGPLVQSEVTTRVEKPYTCDDCGK
HFRWTSDLVRHQRTHTGEKPFFCTICSKSFSQKSVLTTHQRIHVGGKPYVCANCGENFSE
QKQYLTHRKTHVSEEHHLCNECGRSFSHSAAFAKHLKGHASVRNCRCDECGKTFSRRDHL
VRHQRTHTGEKPFTCATCGKSFSRGYHLIRHQRVHTGKTKT
Download sequence
Identical sequences Q8C879
ENSMUSP00000026693 NP_109638.2.92730 XP_011240931.1.92730 10090.ENSMUSP00000026693 ENSMUSP00000026693 ENSMUSP00000026693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]