SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000026893 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000026893
Domain Number 1 Region: 135-442
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.42e-108
Family Transglutaminase core 0.0000000605
Further Details:      
 
Domain Number 2 Region: 4-134
Classification Level Classification E-value
Superfamily E set domains 4.55e-35
Family Transglutaminase N-terminal domain 0.0007
Further Details:      
 
Domain Number 3 Region: 575-669
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.85e-22
Family Transglutaminase, two C-terminal domains 0.0012
Further Details:      
 
Domain Number 4 Region: 460-562
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000068
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000026893   Gene: ENSMUSG00000025787   Transcript: ENSMUST00000026893
Sequence length 670
Comment pep:known chromosome:GRCm38:9:123034741:123067561:1 gene:ENSMUSG00000025787 transcript:ENSMUST00000026893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSRNVLIIYAVNVERKLNAAAHHTSEYQTKKLVLRRGQIFTLKVILNRPLQPQDELKVT
FTSGQRDPPYMVELDPVTSYRSKGWQVKIAKQSGVEVILNVISAADAVVGRYKMRVNEYK
AGVFYLLFNPWCSDDSVFMASEEERAEYILNDTGYMYMGFAKQIKEKPWTFGQFEKHILS
CCFNLLFQLENNEMQNPVLVSRAICTMMCAANGGVLMGNWTGDYADGTAPYVWTSSVPIL
QQHYVTRMPVRYGQCWVFSGILTTALRAVGIPARSVTNFESAHDTEKNLTVDIYLDESGK
TIPHLTKDSVWNFHVWTDAWMKRQDLPHGYDGWQVLDSTPQEISDGGFRTGPSPLTAIRQ
GLIQMKYDTTFVFTEVNGDKFIWLVKQNQEREKNILIAVETASIGKKISTKMVGENRRED
ITLQYKFPEGSPEERKVMAKASGKPSDDKLNSRTLNNSLQISVLQNSLELGAPIYLTITL
KRKTATPQNVNISCSLNLQTYTGNKKTNLGVIQKTVQIHGQESRVFLTMDASYYIYKLGM
VDDEMVIGGFIIAEIVDSGERVATDTTLCFLYSAFSVEMPSTGKVKQPLVITSKFTNTLP
IPLTNIKFSVESLGLANMKSWEQETVPPGKTITFQMECTPVKAGPQKFIVKFISRQVKEV
HAEKVVLISK
Download sequence
Identical sequences A0A0R4J071
ENSMUSP00000026893 ENSMUSP00000026893 NP_808579.2.92730 10090.ENSMUSP00000026893 ENSMUSP00000026893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]