SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000027015 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000027015
Domain Number 1 Region: 141-401
Classification Level Classification E-value
Superfamily Caspase-like 1.12e-81
Family Caspase catalytic domain 0.0000000186
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily DEATH domain 5.1e-23
Family Caspase recruitment domain, CARD 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000027015   Gene: ENSMUSG00000025888   Transcript: ENSMUST00000027015
Sequence length 402
Comment pep:known chromosome:GRCm38:9:5298517:5307265:1 gene:ENSMUSG00000025888 transcript:ENSMUST00000027015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKILRAKRKQFINSVSIGTINGLLDELLEKRVLNQEEMDKIKLANITAMDKARDLCDH
VSKKGPQASQIFITYICNEDCYLAGILELQSAPSAETFVATEDSKGGHPSSSETKEEQNK
EDGTFPGLTGTLKFCPLEKAQKLWKENPSEIYPIMNTTTRTRLALIICNTEFQHLSPRVG
AQVDLREMKLLLEDLGYTVKVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQE
GICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRD
SEEDFLTDAIFEDDGIKKAHIEKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKHMKEYAW
SCDLEDIFRKVRFSFEQPEFRLQMPTADRVTLTKRFYLFPGH
Download sequence
Identical sequences P29452
NP_033937.2.92730 ENSMUSP00000027015 ENSMUSP00000027015 10090.ENSMUSP00000027015 ENSMUSP00000027015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]