SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000027649 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000027649
Domain Number 1 Region: 173-187,290-558
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-68
Family Nuclear receptor ligand-binding domain 0.000000000657
Further Details:      
 
Domain Number 2 Region: 105-188
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.97e-30
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000027649   Gene: ENSMUSG00000026398   Transcript: ENSMUST00000027649
Sequence length 560
Comment pep:known chromosome:GRCm38:1:136843584:136960427:-1 gene:ENSMUSG00000026398 transcript:ENSMUST00000027649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASLDTGDFQEFLKHGLTAIASAPGSETRHSPKREEQLREKRAGLPDRHRRPIPARSRL
VMLPKVETEAPGLVRSHGEQGQMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYG
LLTCESCKGFFKRTVQNQKRYTCIENQNCQIDKTQRKRCPYCRFKKCIDVGMKLEAVRAD
RMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTSAIQNIHSASK
GLPLSHVALPPTDYDRSPFVTSPISMTMPPHSSLHGYQPYGHFPSRAIKSEYPDPYSSSP
ESMMGYSYMDGYQTNSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQSNRNRQEKLSA
FGLLCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVAHGKEG
TIFLVTGEHVDYSTIISHTEVAFNNLLSLAQELVVRLRSLQFDQREFVCLKFLVLFSSDV
KNLENLQLVEGVQEQVNAALLDYTVCNYPQQTEKFGQLLLRLPEIRAISKQAEDYLYYKH
VNGDVPYNNLLIEMLHAKRA
Download sequence
Identical sequences P45448
ENSMUSP00000027649 10090.ENSMUSP00000027649 NP_109601.1.92730 ENSMUSP00000027649 ENSMUSP00000027649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]