SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000027752 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000027752
Domain Number 1 Region: 826-880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000921
Family Laminin-type module 0.0000536
Further Details:      
 
Domain Number 2 Region: 722-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000753
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 284-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family Laminin-type module 0.036
Further Details:      
 
Domain Number 4 Region: 882-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.00012
Further Details:      
 
Domain Number 5 Region: 933-983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 6 Region: 445-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 396-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000276
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 771-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000977
Family Laminin-type module 0.00018
Further Details:      
 
Domain Number 9 Region: 340-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000614
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 10 Region: 981-1026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family Laminin-type module 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000027752
Domain Number - Region: 1277-1524
Classification Level Classification E-value
Superfamily Tropomyosin 0.000438
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number - Region: 98-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00319
Family Galactose-binding domain 0.04
Further Details:      
 
Domain Number - Region: 1074-1274
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00667
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 
Domain Number - Region: 685-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0642
Family Laminin-type module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000027752   Gene: ENSMUSG00000026478   Transcript: ENSMUST00000027752
Sequence length 1607
Comment pep:known chromosome:GRCm38:1:153218922:153332786:-1 gene:ENSMUSG00000026478 transcript:ENSMUST00000027752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGGGRAALALQPRGRLWPLLAVLAAVAGCVRAAMDECADEGGRPQRCMPEFVNAAFNVT
VVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQQHLQHGAAFLTDYNNQADTTWWQSQT
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDK
LMCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCRDNTDGAKCERCRENFFRLGNTEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNVETGRCVCKDNVEGFNCERCKPGFF
NLESSNPKGCTPCFCFGHSSVCTNAVGYSVYDISSTFQIDEDGWRVEQRDGSEASLEWSS
DRQDIAVISDSYFPRYFIAPVKFLGNQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPALSPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLQSARPGPGVPATWVESCTCPVGYGGQFCETCLPGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCPGGSSCA
IVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVT
GQCQCLPHVSGRDCGTCDPGYYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITG
QHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCKEDGRCECREGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEHRVKLQELESLIANLGTGDDMVTDQAFEDRLKEAEREV
TDLLREAQEVKDVDQNLMDRLQRVNSSLHSQISRLQNIRNTIEETGILAERARSRVESTE
QLIEIASRELEKAKMAAANVSITQPESTGEPNNMTLLAEEARKLAERHKQEADDIVRVAK
TANETSAEAYNLLLRTLAGENQTALEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALENEANKIKKEAADLDRLIDQKLKDYEDLREDMRGKEHEVK
NLLEKGKAEQQTADQLLARADAAKALAEEAAKKGRSTLQEANDILNNLKDFDRRVNDNKT
AAEEALRRIPAINRTIAEANEKTREAQLALGNAAADATEAKNKAHEAERIASAVQKNATS
TKADAERTFGEVTDLDNEVNGMLRQLEEAENELKKKQDDADQDMMMAGMASQAAQEAELN
ARKAKNSVSSLLSQLNNLLDQLGQLDTVDLNKLNEIEGSLNKAKDEMKASDLDRKVSDLE
SEARKQEAAIMDYNRDIAEIIKDIHNLEDIKKTLPTGCFNTPSIEKP
Download sequence
Identical sequences F8VQJ3
ENSMUSP00000027752 ENSMUSP00000027752 10090.ENSMUSP00000027752 ENSMUSP00000027752 NP_034813.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]