SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028378 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028378
Domain Number 1 Region: 166-495
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.22e-58
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000193
Further Details:      
 
Domain Number 2 Region: 497-629
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.44e-29
Family Ricin B-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028378   Gene: ENSMUSG00000026994   Transcript: ENSMUST00000028378
Sequence length 633
Comment pep:known chromosome:GRCm38:2:66082766:66124994:-1 gene:ENSMUSG00000026994 transcript:ENSMUST00000028378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHLKRLVKLHIKRHYHRKFWKLGAVIFFFLVVLILMQREVSVQYSKEESKMERNLKNKN
KMLDFMLEAVNNIKDAMPKMQIGAPIKENIDVRERPCLQGYYTAAELKPVFDRPPQDSNA
PGASGKPFKITHLSPEEQKEKERGETKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKR
CPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDDYLHEKLEEYI
KQFSIVKIVRQQERKGLITARLLGAAVATAETLTFLDAHCECFYGWLEPLLARIAENYTA
VVSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTP
TFAGGLFSISKKYFEHIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSK
SPHTFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKSFGDLSKRFEIKKRL
QCKNFTWYLNTIYPEAYVPDLNPVISGYIKSVGQPLCLDVGENNQGGKPLILYTCHGLGG
NQYFEYSAQREIRHNIQKELCLHATQGVVQLKACVYKGHRTIAPGEQIWEIRKDQLLYNP
LFKMCLSSNGEHPNLVPCDATDLLQKWIFSQND
Download sequence
Identical sequences P70419
NP_056551.2.92730 ENSMUSP00000028378 ENSMUSP00000028378 ENSMUSP00000028378 10090.ENSMUSP00000028378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]