SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000028384 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000028384
Domain Number 1 Region: 65-200
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-39
Family Dual specificity phosphatase-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000028384   Gene: ENSMUSG00000027001   Transcript: ENSMUST00000028384
Sequence length 220
Comment pep:known chromosome:GRCm38:2:80617045:80631661:1 gene:ENSMUSG00000027001 transcript:ENSMUST00000028384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSLNQEIKAFSRDNLRKQCTRVTTLTGKKLIETWEDATVHVVETEPSGGGGCGYVQDLT
LDLQVGVIKPWLLLGSQDAAHDLELLRKHKVTHILNVAYGVENAFLSEFTYKTISILDVP
ETNILSYFPECFEFIEQAKLKDGVVLVHCNAGVSRAAAIVIGFLMSSEEATFTTALSLVK
EARPSICPNPGFMEQLRTYQVGKESNGGDKVPAEDTTGGL
Download sequence
Identical sequences Q99N12
ENSMUSP00000028384 ENSMUSP00000028384 ENSMUSP00000028384 NP_077758.1.92730 10090.ENSMUSP00000028384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]