SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000029795 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000029795
Domain Number 1 Region: 272-505
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.27e-60
Family Nuclear receptor ligand-binding domain 0.000000716
Further Details:      
 
Domain Number 2 Region: 28-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-30
Family Nuclear receptor 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000029795   Gene: ENSMUSG00000028150   Transcript: ENSMUST00000029795
Sequence length 516
Comment pep:known chromosome:GRCm38:3:94372794:94397840:1 gene:ENSMUSG00000028150 transcript:ENSMUST00000029795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQ
CNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQQQQQQEQVAKTPPAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGS
GPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELG
EPEQGPDSHCIPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSR
EEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLKAGAMEVVL
VRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTA
LVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCSQHVEK
LQIFQHLHPIVVQAAFPPLYKELFSTDVESPEGLSK
Download sequence
Identical sequences A0A0R4J096
ENSMUSP00000029795 10090.ENSMUSP00000029795 NP_035411.2.92730 ENSMUSP00000029795 ENSMUSP00000029795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]