SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030025 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000030025
Domain Number 1 Region: 364-625
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.65e-56
Family Nuclear receptor ligand-binding domain 0.0000000203
Further Details:      
 
Domain Number 2 Region: 292-369
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.22e-28
Family Nuclear receptor 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030025   Gene: ENSMUSG00000028341   Transcript: ENSMUST00000030025
Sequence length 627
Comment pep:known chromosome:GRCm38:4:48045153:48086445:1 gene:ENSMUSG00000028341 transcript:ENSMUST00000030025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYSPSPPGSTYATQTYGSEYTTEIMNPDYTKLTMDLGSTGIMATATTSLPSFST
FMEGYPSSCELKPSCLYQMPPSGPRPLIKMEEGREHGYHHHHHHHHHHHHHQQQQPSIPP
PSGPEDEVLPSTSMYFKQSPPSTPTTPGFPPQAGALWDDELPSAPGCIAPGPLLDPQMKA
VPPMAAAARFPIFFKPSPPHPPAPSPAGGHHLGYDPTAAAALSLPLGAAAAAGSQAAALE
GHPYGLPLAKRTATLTFPPLGLTASPTASSLLGESPSLPSPPNRSSSSGEGTCAVCGDNA
ACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVK
EVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDATPRDLDYSRY
CPTDQATAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFV
LRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSA
LSMITERHGLKEPKRVEELCTKITSSLKDHQRKGQALEPSEPKVLRALVELRKICTQGLQ
RIFYLKLEDLVPPPSVIDKLFLDTLPF
Download sequence
Identical sequences Q9QZB6
7955.ENSDARP00000100256 ENSMUSP00000030025 NP_056558.1.92730 XP_006537719.1.92730 XP_006537720.1.92730 XP_006537721.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]