SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030420 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000030420
Domain Number 1 Region: 627-913
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-79
Family Protein kinases, catalytic subunit 0.00000000394
Further Details:      
 
Domain Number 2 Region: 30-202
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-69
Family Ephrin receptor ligand binding domain 0.00000185
Further Details:      
 
Domain Number 3 Region: 327-534
Classification Level Classification E-value
Superfamily Fibronectin type III 8.88e-41
Family Fibronectin type III 0.00000376
Further Details:      
 
Domain Number 4 Region: 933-1000
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.09e-19
Family SAM (sterile alpha motif) domain 0.0000355
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000030420
Domain Number - Region: 256-324,375-386
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000224
Family Growth factor receptor domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030420   Gene: ENSMUSG00000028661   Transcript: ENSMUST00000030420
Sequence length 1004
Comment pep:known chromosome:GRCm38:4:136929419:136956816:-1 gene:ENSMUSG00000028661 transcript:ENSMUST00000030420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPARARLSPALWVVTAAAAATCVSAGRGEVNLLDTSTIHGDWGWLTYPAHGWDSINEVD
ESFRPIHTYQVCNVMSPNQNNWLRTNWVPRDGARRVYAEIKFTLRDCNSIPGVLGTCKET
FNLHYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRGVGPLSKRGF
YLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERD
TPKMYCSAEGEWLVPIGKCVCSAGYEERRDACMACELGFYKSAPGDQLCARCPPHSHSAT
PAAQTCRCDLSYYRAALDPPSAACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDIT
YNAVCRRCPWALSHCEACGSGTRFVPQQTSLAQASLLVANLLAHMNYSFWIEAVNGVSNL
SPEPRSAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEKD
KEMQSYSTLKAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDTR
TIVWICLTLITGLVVLLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLNHPP
GKFPETQFSAEPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGESGEVCYGRLQVPGQRD
VPVAIKALKAGYTERQRQDFLSEAAIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGSL
DAFLRTHDGQFTIVQLVGMLRGVGAGMRYLSDLGYIHRDLAARNVLVDGRLVCKVSDFGL
SRALEDDPEAAYTTAGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYWN
MTNQDVISSVEEGYRLPAPMGCPRALHQLMLDCWHKDRAQRPRFAHVVSVLDALVHSPES
LRATATVSRCPPPAFARSCFDLRAGGSGNGDLTVGDWLDSIRMGRYRDHFAAGGYSSLGM
VLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLSSTQGPRRHL
Download sequence
Identical sequences O09127
ENSMUSP00000030420 10090.ENSMUSP00000030420 ENSMUSP00000030420 NP_031965.2.92730 ENSMUSP00000030420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]