SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030747 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000030747
Domain Number 1 Region: 183-452
Classification Level Classification E-value
Superfamily Caspase-like 5.53e-89
Family Caspase catalytic domain 0.000000000963
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-28
Family Caspase recruitment domain, CARD 0.0000361
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030747   Gene: ENSMUSG00000028914   Transcript: ENSMUST00000030747
Sequence length 454
Comment pep:known chromosome:GRCm38:4:141793612:141815976:1 gene:ENSMUSG00000028914 transcript:ENSMUST00000030747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEADRQLLRRCRVRLVSELQVAELWDALLSRELFTRDMIEDIQQAGSGSRRDQARQLVT
DLETRGRQALPLFISCLEDTGQGTLASLLQSGRQAAKQDPEAVKPLDHLVPVVLGPMGLT
AKEQRVVKLDPSQPAVGNLTPVVLGPEELWPARLKPEVLRPETPRPVDIGSGGAHDVCVP
GKIRGHADMAYTLDSDPCGHCLIINNVNFCPSSGLGTRTGSNLDRDKLEHRFRWLRFMVE
VKNDLTAKKMVTALMEMAHRNHRALDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIEK
IVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTSSQGRTLDSDSEPDAVPYQEG
PRPLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDGILEQWARSEDLQS
LLLRVANAVSAKGTYKQIPGCFNFLRKKLFFKTS
Download sequence
Identical sequences Q8C3Q9
ENSMUSP00000030747 10090.ENSMUSP00000030747 ENSMUSP00000030747 NP_056548.2.92730 ENSMUSP00000030747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]