SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030751 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000030751
Domain Number 1 Region: 4-161
Classification Level Classification E-value
Superfamily RUN domain-like 4.32e-32
Family RUN domain 0.0015
Further Details:      
 
Domain Number 2 Region: 762-866
Classification Level Classification E-value
Superfamily PH domain-like 8.13e-20
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030751   Gene: ENSMUSG00000028917   Transcript: ENSMUST00000030751
Sequence length 1013
Comment pep:novel chromosome:GRCm38:4:141625734:141664899:-1 gene:ENSMUSG00000028917 transcript:ENSMUST00000030751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPREVKDRILENISLSVKKLQSYFAACEDETPAIRNHDKVLQRLCEHLDHALLYGLQDL
SSGYWVLVVHFTRREAIRQIEVLQHVATNLGRSRAWLYLALNENSLESYLRLFQENLGLL
QKYYVRNALVCSHDHLTLFLTLVSGLEFIRFDLDLDAPYLDLAPYMPDYYKPQYLLDFED
RLPSSVHGSDSLSLNSFNSVTSTNLEWDDSAIAPSSEDGDLTDTISGPRSTASDLTSSKT
STKSPTQRHNPFNEEQAETASSDTTPVHTTSQEKEEAQAPDQPDACTELEVIRVTKKKKI
GKKKKTKLDEDASPLHPTSSQQKCGQQGEGDGLVGTPGLARDPSDTVLASPQEQGEGLSS
TAGSSELSELSQMGLLIPEMKDTSMECLGQPLSKVIDKLHGQLDPSTWCSHADPPEQSFR
AGSPGEAPEKPPFCDFSEGLPAPMDFYRFTVESPSTVAPGGGHHDPPGPSQPLHVPGSPA
AALQEEEEGGGRGEGQTSQPLEDRQGEEIQEPEPQEPDSQLPLVSQEPVPEPVSQPEPGT
HEALCKLKRDQPSPCLSSAEDSGVEEGQGSPSEMTHPSEFRVDNNHLLLLMIHVFRENEE
QLFKMIRMSTGHMEGNLQLLYVLLTDCYVYLLRKGATEKPYLVEEAVSYNELDYVSVGLD
QQTVKLVCTNRRKQFLLDTADVALAELFLASLKSAMIKGCREPPYPSILTDATMEKLALA
KFVAQESKCEASAVTVHFYGLVHWEDPMEEALGPVPCQCSPAEGTITKEGMLHYKASTSY
LGKEHWKACFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGCRRSNTTDRPHAFQVILA
DRPCLELSADSEAEMADWMQHLCQAVSKGVIPQGIAPSPCIPCCLVITEDRLFTCHEDCQ
TSFFRSLGTARLADITAISTELGKEYCVLEFSQDSPQLLQPWVIYLSCTSELDRFLTALS
SGWKAIYQVDLPHKAIHEASIKQKFEDALSLIHSAWQRSDSLCRGRASRDPWC
Download sequence
Identical sequences A2ADE0
ENSMUSP00000030751 XP_006539219.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]