SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000031229 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000031229
Domain Number 1 Region: 66-231
Classification Level Classification E-value
Superfamily RUN domain-like 9.42e-53
Family RUN domain 0.0000000243
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000031229
Domain Number - Region: 271-318
Classification Level Classification E-value
Superfamily Prefoldin 0.000942
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000031229   Gene: ENSMUSG00000029291   Transcript: ENSMUST00000031229
Sequence length 469
Comment pep:known chromosome:GRCm38:5:88583574:88642671:1 gene:ENSMUSG00000029291 transcript:ENSMUST00000031229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHED
PNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKK
TFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGRGRAWLRLALMQKKLSEYM
KALINKKELLSEFYEVNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQVGVIDFSM
YLKDGNSSKGSEGDGQITAILDQKNYVEELNRHLNATVNNLQTKVDLLEKSNTKLTEELA
VANNRIITLQEEMERVKEESSYLLESNRKGPKQDRTAEGQALSEARKHLKEETQLRLDVE
KELELQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVK
QKSELNSRLEEKTNQMAATIKQLEQSEKDLVKQAKTLNSAANKLIPKHH
Download sequence
Identical sequences Q9D394
NP_081806.1.92730 ENSMUSP00000031229 ENSMUSP00000031229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]