SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000032874 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000032874
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-76
Family BAR domain 0.0000000686
Further Details:      
 
Domain Number 2 Region: 265-344
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-22
Family SH3-domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000032874   Gene: ENSMUSG00000030638   Transcript: ENSMUST00000032874
Sequence length 347
Comment pep:known chromosome:GRCm38:7:82174796:82307419:1 gene:ENSMUSG00000030638 transcript:ENSMUST00000032874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKASQLFSEKISGAEGTKLDEEFLNMEKKIDITSKAVAEILSKATEYLQP
NPAYRAKLGMLNTVSKLRGQVKATGYPQTEGLLGDCMLKYGKELGEDSAFGNSLVDVGEA
LKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPE
EEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFVEAALDYHRQSTEILQELQSKL
ELRISLASKVPKREFMPKPVNMSSTDANGVGPSSSSKTPGTDTPSDQPCCRGLYDFEPEN
EGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEVIVPLPP
Download sequence
Identical sequences A0A0R4J0B8
ENSMUSP00000032874 GO.34307 ENSMUSP00000032874 ENSMUSP00000032874 NP_059096.3.92730 10090.ENSMUSP00000032874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]