SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000033121 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000033121
Domain Number 1 Region: 321-394
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000687
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 118-194
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000104
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 3 Region: 956-1045
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000353
Family Carboxypeptidase regulatory domain 0.02
Further Details:      
 
Domain Number 4 Region: 875-947
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000745
Family Rhamnogalacturonase B, RhgB, middle domain 0.037
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000033121
Domain Number - Region: 207-291
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00392
Family Rhamnogalacturonase B, RhgB, middle domain 0.023
Further Details:      
 
Domain Number - Region: 802-861
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00628
Family Cna protein B-type domain 0.0094
Further Details:      
 
Domain Number - Region: 43-107
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00824
Family Cna protein B-type domain 0.011
Further Details:      
 
Domain Number - Region: 434-483
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0388
Family Carboxypeptidase regulatory domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000033121   Gene: ENSMUSG00000030835   Transcript: ENSMUST00000033121
Sequence length 1214
Comment pep:known chromosome:GRCm38:7:46033698:46084212:1 gene:ENSMUSG00000030835 transcript:ENSMUST00000033121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAGRCAAALLLLLLSGAGRAIGSEDIVVGCGGFVKSDVEINYSLIEIKLYTKHGTLKYQ
TDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTNVELRVDGVSDICTKGGDINFLFTG
FSVNGKVLSKGQPLGPAGVQVSLRSTGADSKIQSTVTQPGGKFAFFKVLPGDYEILATHP
TWALKEASTTVRVTNSNANAAGPLIVAGYNVSGSVRSDGEPMKGVKFLLFSSLVNKEDVL
GCNVSPVSGFQPPDESLVYLCYAVSKEDGSFSFYSLPSGGYTVVPFYRGERITFDVAPSR
LDFTVEHDSLRIEPVFHVMGFSVTGRVLNGPDGEGVPEAVVTLNNQIKVKTKADGSFRLE
NITTGTYTIHAQKEHLYFEMVTIKIAPNTPQLADLIATGFSICGQIAIVRSPDTIKQMSK
YRVVLSSQDKDKALLTVDSDAHGSFCFKAKPGAYKVQVVVPEAETRAGLMLKPQVFPLTV
TNRPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKVNSMTFTFD
KVLPGRYKISIMHEDWCWRNKSLEVEVLEDDVSAVEFRQTGYMLRCALSHAITLEFHQDG
NGPENVGIYNLSRGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILTLTAIRHHV
LGTIITDKMMDVTVTIKSSIDSEPALVLGPLKSAQELRREQQLAEIETRRQEREKNGKEE
GEEGRARPPGQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSMEATVSGESC
PGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLE
YTVNSQKEGYVLTAVEGTVGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGGVFRSNLLT
QDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLRITITGFRTAYSCYGTVS
SLNGEPEQGVAVEAVGQKDCSIYGEDTVTDEEGKFRLRGLLPGCMYHVQLKAEGNDHIER
ALPHHRVIEVGNNDVDDVNIIVFRQINQFDLSGNVITSSEYLSTLWVKLYKSESLDNPIQ
TVSLGQSLFFHFPPLLRDGENYVVLLDTTLPRSQYDYVLPQVSFTAVGYHKHITLVFSPT
RKLPEQDIAQGSYIALPLTLLLLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASDSSGPE
DMKRQTKKQKTRRT
Download sequence
Identical sequences Q6GQT9
ENSMUSP00000033121 NP_694697.3.92730 ENSMUSP00000033121 ENSMUSP00000033121 10090.ENSMUSP00000033121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]