SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Mus musculus 76_38 > ENSMUSP00000034359

Domain assignment for ENSMUSP00000034359 from Mus musculus 76_38

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMUSP00000034359
Domain Number 1	Region: 8-165
Classification Level	Classification	E-value
Superfamily	TRADD, N-terminal domain	2.88e-66
Family	TRADD, N-terminal domain	0.000000451
Further Details:

Domain Number 2	Region: 217-307
Classification Level	Classification	E-value
Superfamily	DEATH domain	0.00000000000000443
Family	DEATH domain, DD	0.0094
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMUSP00000034359 Gene: ENSMUSG00000031887 Transcript: ENSMUST00000034359
Sequence length	310
Comment	pep:known chromosome:GRCm38:8:105258286:105264609:-1 gene:ENSMUSG00000031887 transcript:ENSMUST00000034359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQ ILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRA GAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGS KFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCR ALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLL GQAEPDGGLA
Download sequence
Identical sequences	B2RRZ7 Q3U0V2 ENSMUSP00000034359 10090.ENSMUSP00000034359 ENSMUSP00000034359 ENSMUSP00000034359 NP_001028333.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]