SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034766 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034766
Domain Number 1 Region: 272-511
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-70
Family Nuclear receptor ligand-binding domain 0.000000000647
Further Details:      
 
Domain Number 2 Region: 70-155
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.48e-32
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034766   Gene: ENSMUSG00000032238   Transcript: ENSMUST00000034766
Sequence length 523
Comment pep:known chromosome:GRCm38:9:68653786:69388246:1 gene:ENSMUSG00000032238 transcript:ENSMUST00000034766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESAPAAPDPAASEPGSSGSEAAAGSRETPLTQDTGRKSEAPGAGRRQSYASSSRGISVT
KKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRT
SRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAE
PLTPTYNISANGLTELHDDLSTYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIK
PEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITW
QTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGS
LEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRAL
CGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
Download sequence
Identical sequences P51448
NP_038674.1.92730 ENSMUSP00000034766 ENSMUSP00000034766 10090.ENSMUSP00000034766 ENSMUSP00000034766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]